(data stored in ACNUC7421 zone)

EMBL: CP002047.PE346

CP002047.PE346       Location/Qualifiers
FT   CDS             complement(407535..408038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03467"
FT                   /db_xref="GOA:D7BYD9"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYD9"
FT                   /protein_id="ADI03467.1"
FT                   /translation="MIALIVVVFVLAVACFVAGAKSSAGSTSNAVLSRRTGWLVYGVLL
FT                   VALGLYLVNVYREQTWSDGEVGAVAREAAEAVDGATYASAYTVHDAVEDHLRRAAKGKG
FT                   AWEDLHVLNQGLDFTVFAEEDGPAHCIQVTTTDATVGGAGTTGSGTGTVEGVRVSATVS
FT                   DGRC"
     MIALIVVVFV LAVACFVAGA KSSAGSTSNA VLSRRTGWLV YGVLLVALGL YLVNVYREQT        60
     WSDGEVGAVA REAAEAVDGA TYASAYTVHD AVEDHLRRAA KGKGAWEDLH VLNQGLDFTV       120
     FAEEDGPAHC IQVTTTDATV GGAGTTGSGT GTVEGVRVSA TVSDGRC                     167
//

If you have problems or comments...

PBIL Back to PBIL home page