(data stored in ACNUC7421 zone)

EMBL: CP002047.PE356

CP002047.PE356       Location/Qualifiers
FT   CDS             420695..422023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00356"
FT                   /product="hypothetical protein"
FT                   /note="COG2755 Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03477"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE9"
FT                   /protein_id="ADI03477.1"
FT                   /translation="MPATVLPIVMLVSGAQGAERSEAHTAPAGGSAGAAPPAGTHWVGT
FT                   WAAMPQLTEPGNMPPAPYTQDGTVLADSTLRQTVHISVGGNHLRLRFSNAFGGAPLPIT
FT                   RVSVALPMNGRAGVSTIKPGTSRPVTFHGRTSTTVPTGAQVVSDPLDFELAAGSNLTVT
FT                   AYLATGQQSTAITSHPGSRTTSYLLRGDHVEATDLAGAASVDHWYFLSGVETWSPARTR
FT                   ATAVLGDSLTDGRGSTTNQNDRWTDRLMTRLRTDRRTADTAVLNQAAGGNRVLTDGLGP
FT                   GGLSRVDRDVLVQPGVTSLIVFEGVNDIGTAPATPDAQKDVADRLIAAYDQIIMRAHAQ
FT                   GIRVYGATITPFGGNHDYDDAAGHREATRQRVNDWIRTSGRFDAVVDLDRAARDNDDPR
FT                   RLRPDLDVGDHLHFNPDGYRVLGDAFPLALFVNRPLPPGFGYN"
     MPATVLPIVM LVSGAQGAER SEAHTAPAGG SAGAAPPAGT HWVGTWAAMP QLTEPGNMPP        60
     APYTQDGTVL ADSTLRQTVH ISVGGNHLRL RFSNAFGGAP LPITRVSVAL PMNGRAGVST       120
     IKPGTSRPVT FHGRTSTTVP TGAQVVSDPL DFELAAGSNL TVTAYLATGQ QSTAITSHPG       180
     SRTTSYLLRG DHVEATDLAG AASVDHWYFL SGVETWSPAR TRATAVLGDS LTDGRGSTTN       240
     QNDRWTDRLM TRLRTDRRTA DTAVLNQAAG GNRVLTDGLG PGGLSRVDRD VLVQPGVTSL       300
     IVFEGVNDIG TAPATPDAQK DVADRLIAAY DQIIMRAHAQ GIRVYGATIT PFGGNHDYDD       360
     AAGHREATRQ RVNDWIRTSG RFDAVVDLDR AARDNDDPRR LRPDLDVGDH LHFNPDGYRV       420
     LGDAFPLALF VNRPLPPGFG YN                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page