(data stored in ACNUC7421 zone)

EMBL: CP002047.PE360

CP002047.PE360       Location/Qualifiers
FT   CDS             complement(424013..425662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00360"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03481"
FT                   /db_xref="GOA:D7BYF3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF3"
FT                   /protein_id="ADI03481.1"
FT                   /translation="MSYGSDSGGRAGRAGIEGWLIGGRYRIAERIGSGGMGTVWRAHDE
FT                   LVDREVAVKQPKISGDPEDPTFHRTAERLYREARAAARVEHPAAVAIHDVVVEDGLPWI
FT                   VMELVRGEALDKVLRRGALPPAEAARIGLAVVDALSAAHSVGVIHRDVKPANVLLGQNG
FT                   RVVLTDFGIAQIQGEESLTASGEFVGSIEFIAPERMSGRGAGAAADLWSLGVVLYAAVQ
FT                   GWSPFRRDTLESTLAAILAAEPPEPERAGPLGPLILRLLAKEPDLRANAEEAAATLRAV
FT                   AEGRPSPYGPEPLVATQHGRQLEEFGESRGKAGQTGGAGAPPAAVTPSHAHTTGPAPKR
FT                   PYTTGQLLAIALVGVLAVGGAVWAGVTAGDDGASSVAEKTTGPSTSGSPSPRPGTWTAH
FT                   REKQLDAIVSVPAGTLEYDRSDSGADRRNPSQWVAYGDKTVQLRLTRKEAVPTTIKEWA
FT                   SEATLSWADDNAQTLYAPTSFHGYEAMATDTTYEVKDKKYRAMQLLITTSAQEHYELRV
FT                   DMPKGGKDESRGHLLFTGARARLKVGKAMVSP"
     MSYGSDSGGR AGRAGIEGWL IGGRYRIAER IGSGGMGTVW RAHDELVDRE VAVKQPKISG        60
     DPEDPTFHRT AERLYREARA AARVEHPAAV AIHDVVVEDG LPWIVMELVR GEALDKVLRR       120
     GALPPAEAAR IGLAVVDALS AAHSVGVIHR DVKPANVLLG QNGRVVLTDF GIAQIQGEES       180
     LTASGEFVGS IEFIAPERMS GRGAGAAADL WSLGVVLYAA VQGWSPFRRD TLESTLAAIL       240
     AAEPPEPERA GPLGPLILRL LAKEPDLRAN AEEAAATLRA VAEGRPSPYG PEPLVATQHG       300
     RQLEEFGESR GKAGQTGGAG APPAAVTPSH AHTTGPAPKR PYTTGQLLAI ALVGVLAVGG       360
     AVWAGVTAGD DGASSVAEKT TGPSTSGSPS PRPGTWTAHR EKQLDAIVSV PAGTLEYDRS       420
     DSGADRRNPS QWVAYGDKTV QLRLTRKEAV PTTIKEWASE ATLSWADDNA QTLYAPTSFH       480
     GYEAMATDTT YEVKDKKYRA MQLLITTSAQ EHYELRVDMP KGGKDESRGH LLFTGARARL       540
     KVGKAMVSP                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page