(data stored in ACNUC7421 zone)

EMBL: CP002047.PE361

CP002047.PE361       Location/Qualifiers
FT   CDS             complement(425726..426595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00361"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="COG0842 ABC-type multidrug transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03482"
FT                   /db_xref="GOA:D7BYF4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF4"
FT                   /protein_id="ADI03482.1"
FT                   /translation="MSEAPVAPRHGSAETVGLAPDGRPDPLLTPPRPRTGWRMLPARVG
FT                   AMCVVELQKLRHDRTELYTRAVQPALWLLIFGETFTRLKAIPTGGTPYIDYLAPGIIAQ
FT                   SAMFIAIFYGIQIIWERDAGILTKLLVTPTPRAALITGKAFAAGVKALIQAVVVIVIAA
FT                   LLGVALTWNPLRLLGVAVAVILGSAFFSCLSMTIAGIVLTRDRLMGIGQAITMPLFFGS
FT                   NALYPVALMPGWLQAVSTANPLSYQVDALRGLLLGTPHHLALDYLVLVLAAAAGIAAAS
FT                   SLLGRLAR"
     MSEAPVAPRH GSAETVGLAP DGRPDPLLTP PRPRTGWRML PARVGAMCVV ELQKLRHDRT        60
     ELYTRAVQPA LWLLIFGETF TRLKAIPTGG TPYIDYLAPG IIAQSAMFIA IFYGIQIIWE       120
     RDAGILTKLL VTPTPRAALI TGKAFAAGVK ALIQAVVVIV IAALLGVALT WNPLRLLGVA       180
     VAVILGSAFF SCLSMTIAGI VLTRDRLMGI GQAITMPLFF GSNALYPVAL MPGWLQAVST       240
     ANPLSYQVDA LRGLLLGTPH HLALDYLVLV LAAAAGIAAA SSLLGRLAR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page