(data stored in ACNUC7421 zone)

EMBL: CP002047.PE364

CP002047.PE364       Location/Qualifiers
FT   CDS             427892..428041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03485"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF7"
FT                   /protein_id="ADI03485.1"
FT                   /translation="MPKGRSAQVTDAMADLLGALVGSLTRDMADFTLTLRMAQSVSLYA
FT                   SRWS"
     MPKGRSAQVT DAMADLLGAL VGSLTRDMAD FTLTLRMAQS VSLYASRWS                    49
//

If you have problems or comments...

PBIL Back to PBIL home page