(data stored in ACNUC7421 zone)

EMBL: CP002047.PE365

CP002047.PE365       Location/Qualifiers
FT   CDS             428041..428403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00365"
FT                   /product="putative 2Fe-2S rieske nitrite reductase small
FT                   subunit"
FT                   /note="COG2146 Ferredoxin subunits of nitrite reductase and
FT                   ring-hydroxylating dioxygenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03486"
FT                   /db_xref="GOA:D7BYF8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYF8"
FT                   /protein_id="ADI03486.1"
FT                   /translation="MIPVCRLADLPRGEAFRFENIPPIAVFHTDAGEVYAIDDTCTHQD
FT                   ASLSDGWLEGCEVECPLHASKFDLRTGRVDAPPAKLPVRAHQVVVEDGMIYVQLSQDAP
FT                   NLPPCVAHRLAGEGAA"
     MIPVCRLADL PRGEAFRFEN IPPIAVFHTD AGEVYAIDDT CTHQDASLSD GWLEGCEVEC        60
     PLHASKFDLR TGRVDAPPAK LPVRAHQVVV EDGMIYVQLS QDAPNLPPCV AHRLAGEGAA       120
//

If you have problems or comments...

PBIL Back to PBIL home page