(data stored in ACNUC7421 zone)

EMBL: CP002047.PE367

CP002047.PE367       Location/Qualifiers
FT   CDS             429638..430759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00367"
FT                   /product="putative ring hydroxylating dioxygenase subunit"
FT                   /note="COG4638 Phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03488"
FT                   /db_xref="GOA:D7BYG0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG0"
FT                   /protein_id="ADI03488.1"
FT                   /translation="MTATSLPPSLIRTLSGEHYTDPAIFALEQERVFEAMWFCVARSAD
FT                   LAEPGQFRTYQVGRESVLISRSRDGSVKGFLNICRHRGAKLCLEASGEVKRAFQCPYHA
FT                   WTYGLDGKLVAAPNLTSMPDIDRGEYGLVNVHIREWLGYVWASLADAPPSFEQDVIGAV
FT                   IERLGDVAAIDNYRIENLEVGRRITYDVKANWKLIVENFMECYHCATIHPELTEVLPEF
FT                   ADGYAAQYYVGHGAEFGADVQGFTVDGGEGLDRIPGVGEDQDRRYYAITVRPQVFINLV
FT                   PDHVIFHRMYPMAPDRTVVECDWLYLPHVVESGQDVTRSVELFHRVNQQDFDACERTQP
FT                   AMSSRAYAKGGVLVPSEHHIGAFHTWLQNKLSA"
     MTATSLPPSL IRTLSGEHYT DPAIFALEQE RVFEAMWFCV ARSADLAEPG QFRTYQVGRE        60
     SVLISRSRDG SVKGFLNICR HRGAKLCLEA SGEVKRAFQC PYHAWTYGLD GKLVAAPNLT       120
     SMPDIDRGEY GLVNVHIREW LGYVWASLAD APPSFEQDVI GAVIERLGDV AAIDNYRIEN       180
     LEVGRRITYD VKANWKLIVE NFMECYHCAT IHPELTEVLP EFADGYAAQY YVGHGAEFGA       240
     DVQGFTVDGG EGLDRIPGVG EDQDRRYYAI TVRPQVFINL VPDHVIFHRM YPMAPDRTVV       300
     ECDWLYLPHV VESGQDVTRS VELFHRVNQQ DFDACERTQP AMSSRAYAKG GVLVPSEHHI       360
     GAFHTWLQNK LSA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page