(data stored in ACNUC7421 zone)

EMBL: CP002047.PE369

CP002047.PE369       Location/Qualifiers
FT   CDS             431772..434210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00369"
FT                   /product="putative dehydrogenase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03490"
FT                   /db_xref="GOA:D7BYG2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG2"
FT                   /protein_id="ADI03490.1"
FT                   /translation="MAGPRVVIIGAGVVGAALADELSTRGWTDITVVDQGPLPATGGST
FT                   SHAPGLVFQTNSSKTMTELARYTVEKFCSLEVAGQPCFLQVGGLEIATTPERLAELRRR
FT                   HGWVTSWGVEARLIGPDECVELHPLVDRERVLGGLLVPTDGLAKAVLAVEAQLTAARER
FT                   GVRTLGRHEVLDIREEDGRVSAVVTDHGEIPADIVVCCAGIWGPKVARMVGMNLPLTPL
FT                   AHQLAWTGPVPALAGQAEEAVRPILRHQDADLYYRDRFDQLGIGYYGHRTMPVSPDDIA
FT                   SVDSAEHMPSVLRFTKDDFTDAWSETQALLPATKDAKIEEGINGLFSFTTDGLPLLGES
FT                   PDVKGFWVAEAVWVTHSAGVGRAVAEWLVDGHCTSFDLHECDVNRFEPHQLAPEYVLAR
FT                   DCRNFVEVYDILHPLQPTGAPRPLRTSPFHPRQQELGGYFLEASGWERPQWYATNEALL
FT                   KGRNIPTPNDWAARYWSPIVGAEAQATRESVALYDMTALKRLEVTGRGAAGLLQRMTTA
FT                   NVDKSVGSVTYTLMLDHNGGIRSDITVARLGRGHFQVGAGGNLDLDWLTRHLPEDGSVT
FT                   VRDITGGTCCIGLWGPKARDMLQPLADQDFSNAGLRYFRARKAHIGPVPVTAMRLSYVG
FT                   ELGWELYTTADMGLKLWDTLWEAARPHGGIAAGRGAFNSLRLEKGYRSFGTDMTYEHDP
FT                   YEAGVGFAVKMDKGDFIGRAALERRAADVRRRLVCLTIDDPHAVVMGKEPVYDGARPVG
FT                   YVTSAAYGYTIGKGIAYAWLPADLATAGRSLTIGYFDQRVPAAVAEEPLFDPNMQRLRG
FT                   "
     MAGPRVVIIG AGVVGAALAD ELSTRGWTDI TVVDQGPLPA TGGSTSHAPG LVFQTNSSKT        60
     MTELARYTVE KFCSLEVAGQ PCFLQVGGLE IATTPERLAE LRRRHGWVTS WGVEARLIGP       120
     DECVELHPLV DRERVLGGLL VPTDGLAKAV LAVEAQLTAA RERGVRTLGR HEVLDIREED       180
     GRVSAVVTDH GEIPADIVVC CAGIWGPKVA RMVGMNLPLT PLAHQLAWTG PVPALAGQAE       240
     EAVRPILRHQ DADLYYRDRF DQLGIGYYGH RTMPVSPDDI ASVDSAEHMP SVLRFTKDDF       300
     TDAWSETQAL LPATKDAKIE EGINGLFSFT TDGLPLLGES PDVKGFWVAE AVWVTHSAGV       360
     GRAVAEWLVD GHCTSFDLHE CDVNRFEPHQ LAPEYVLARD CRNFVEVYDI LHPLQPTGAP       420
     RPLRTSPFHP RQQELGGYFL EASGWERPQW YATNEALLKG RNIPTPNDWA ARYWSPIVGA       480
     EAQATRESVA LYDMTALKRL EVTGRGAAGL LQRMTTANVD KSVGSVTYTL MLDHNGGIRS       540
     DITVARLGRG HFQVGAGGNL DLDWLTRHLP EDGSVTVRDI TGGTCCIGLW GPKARDMLQP       600
     LADQDFSNAG LRYFRARKAH IGPVPVTAMR LSYVGELGWE LYTTADMGLK LWDTLWEAAR       660
     PHGGIAAGRG AFNSLRLEKG YRSFGTDMTY EHDPYEAGVG FAVKMDKGDF IGRAALERRA       720
     ADVRRRLVCL TIDDPHAVVM GKEPVYDGAR PVGYVTSAAY GYTIGKGIAY AWLPADLATA       780
     GRSLTIGYFD QRVPAAVAEE PLFDPNMQRL RG                                     812
//

If you have problems or comments...

PBIL Back to PBIL home page