(data stored in ACNUC7421 zone)

EMBL: CP002047.PE370

CP002047.PE370       Location/Qualifiers
FT   CDS             434352..435368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00370"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="COG0596 Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03491"
FT                   /db_xref="GOA:D7BYG3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG3"
FT                   /protein_id="ADI03491.1"
FT                   /translation="MDIPEGISHSRRHFLGAAAATAVAAQFAMTGDTLARSGIDTSFGP
FT                   VKQIKAGDLNVGYVEAGPASGPPVVLLHGWPYDIHSYVEVAPLLAAKGYRVVVPYLRGH
FT                   GTTRFLSGKTPRDAQQSAFALDIIALMDALEIDRAILAGYDWGSRTADIIAALWPERCK
FT                   ALISVTGYLIVNVEANRFPTPPKSEWAWWYQYYFATERGVRGLRKYRHDLAKLVWKFNS
FT                   PTWKFSDATFDRTAAAFDNPDYVSIVIDNYRWRLGLAKGEPRYAAIEKRLAAAPVIKVP
FT                   TITIDGAYDPFTPPGHGSAYRKKFVGKYAHQTLKVGHNVPQEAPRAFAAAVVEVDGF"
     MDIPEGISHS RRHFLGAAAA TAVAAQFAMT GDTLARSGID TSFGPVKQIK AGDLNVGYVE        60
     AGPASGPPVV LLHGWPYDIH SYVEVAPLLA AKGYRVVVPY LRGHGTTRFL SGKTPRDAQQ       120
     SAFALDIIAL MDALEIDRAI LAGYDWGSRT ADIIAALWPE RCKALISVTG YLIVNVEANR       180
     FPTPPKSEWA WWYQYYFATE RGVRGLRKYR HDLAKLVWKF NSPTWKFSDA TFDRTAAAFD       240
     NPDYVSIVID NYRWRLGLAK GEPRYAAIEK RLAAAPVIKV PTITIDGAYD PFTPPGHGSA       300
     YRKKFVGKYA HQTLKVGHNV PQEAPRAFAA AVVEVDGF                               338
//

If you have problems or comments...

PBIL Back to PBIL home page