(data stored in ACNUC7421 zone)

EMBL: CP002047.PE371

CP002047.PE371       Location/Qualifiers
FT   CDS             435474..437144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00371"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.38"
FT                   /note="COG0281 Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03492"
FT                   /db_xref="GOA:D7BYG4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG4"
FT                   /protein_id="ADI03492.1"
FT                   /translation="MTETRRRTPATPAALADPPRNHGVAFTQEERDALGLTGRLPSGVL
FT                   TLDQQAQRAYQQMNAQGGDLAKNVYLEQLHDRNETLYFKVLSDHLAELLPIVYDPTVGE
FT                   AIEKYSNEYRRPRGIFLSIDRPEDMERAFATLELGPEDVDLIVCSDAEQILGIGDWGVG
FT                   GIQIAVGKLAVYTAAAGVDPRRVVPVSLDVGTDRKSLLDDPLYLGNRHPRVRGADYDAF
FT                   MEKYLETASSLFPHALLHFEDFGPSNARRILEQYGRRYRIFNDDMQGTGAITLAAALSA
FT                   VKVSGVRMRDQRLVVFGAGTAGVGIADQLRDAMVRDGADRGQATGQVWLIDKQGLLIRG
FT                   MADLRDFQQPYARDPAEVADWARDDGAISLLETVRRVKPTILLGTSTVHGAFTREVVQA
FT                   MSEGTERPIVLPLSNPTSRIEAMPADVIAWSKGKALVATGIPVAPVEYGGVTYRIGQAN
FT                   NALLYPGLGLGTIVSGASQVTAGMLLAAAQAVADQVDASGPGASLLPPVENLRESSAIT
FT                   ATAVVKAALDEGVATCKPADVADAVREAMWQPAYTAGAT"
     MTETRRRTPA TPAALADPPR NHGVAFTQEE RDALGLTGRL PSGVLTLDQQ AQRAYQQMNA        60
     QGGDLAKNVY LEQLHDRNET LYFKVLSDHL AELLPIVYDP TVGEAIEKYS NEYRRPRGIF       120
     LSIDRPEDME RAFATLELGP EDVDLIVCSD AEQILGIGDW GVGGIQIAVG KLAVYTAAAG       180
     VDPRRVVPVS LDVGTDRKSL LDDPLYLGNR HPRVRGADYD AFMEKYLETA SSLFPHALLH       240
     FEDFGPSNAR RILEQYGRRY RIFNDDMQGT GAITLAAALS AVKVSGVRMR DQRLVVFGAG       300
     TAGVGIADQL RDAMVRDGAD RGQATGQVWL IDKQGLLIRG MADLRDFQQP YARDPAEVAD       360
     WARDDGAISL LETVRRVKPT ILLGTSTVHG AFTREVVQAM SEGTERPIVL PLSNPTSRIE       420
     AMPADVIAWS KGKALVATGI PVAPVEYGGV TYRIGQANNA LLYPGLGLGT IVSGASQVTA       480
     GMLLAAAQAV ADQVDASGPG ASLLPPVENL RESSAITATA VVKAALDEGV ATCKPADVAD       540
     AVREAMWQPA YTAGAT                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page