(data stored in ACNUC7421 zone)

EMBL: CP002047.PE373

CP002047.PE373       Location/Qualifiers
FT   CDS             438061..439014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03494"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG6"
FT                   /protein_id="ADI03494.1"
FT                   /translation="MSTSIRVWPRLVYEELAPMVAFVNRLVQVAGKYTLDEPFEVGWGN
FT                   IVLDVTPRGLRTPTLRKRDVTFTVHYRLLDGDVVIEADSGTRTVPLFDESLAAFYASFC
FT                   HAVGDLGIRRPGSSLICEIPDAPATFGDDRVERHWDDRTAGLIWSALNLAAGGLEAWQA
FT                   PFQGHRPRVGVMWGGFDLSATRHRARPTAPPAQVPAFQQNAQIEEYMAVGFAFGTPDAP
FT                   DPGMYAYIWPQPDGLEGRSWGVDGAAWNPDAGLVLLPWATLRDTPNPHQSIVAFGDAVY
FT                   DAAVETAGWPSDLVGPRCDGWYMSRTPPSLAEARHH"
     MSTSIRVWPR LVYEELAPMV AFVNRLVQVA GKYTLDEPFE VGWGNIVLDV TPRGLRTPTL        60
     RKRDVTFTVH YRLLDGDVVI EADSGTRTVP LFDESLAAFY ASFCHAVGDL GIRRPGSSLI       120
     CEIPDAPATF GDDRVERHWD DRTAGLIWSA LNLAAGGLEA WQAPFQGHRP RVGVMWGGFD       180
     LSATRHRARP TAPPAQVPAF QQNAQIEEYM AVGFAFGTPD APDPGMYAYI WPQPDGLEGR       240
     SWGVDGAAWN PDAGLVLLPW ATLRDTPNPH QSIVAFGDAV YDAAVETAGW PSDLVGPRCD       300
     GWYMSRTPPS LAEARHH                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page