(data stored in ACNUC7421 zone)

EMBL: CP002047.PE376

CP002047.PE376       Location/Qualifiers
FT   CDS             443608..444504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00376"
FT                   /product="hydroxyquinol 1,2-dioxygenase"
FT                   /note="COG3485 Protocatechuate 3,4-dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03497"
FT                   /db_xref="GOA:D7BYG9"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYG9"
FT                   /protein_id="ADI03497.1"
FT                   /translation="MTTTPAVSDQQPGTEDELVRTVLASFRNTPDPRLKEVMRALVLHL
FT                   HAFIREVRLTEAEWQQAIDFLTAAGHIATDRRQEFVLLSDVLGASMQTINVNHEATADA
FT                   TEATVVGPFFVEDSPEIPLGGDLAAGAPGEPCWVEGTVTDTDGNPVPGARLEVWEADED
FT                   GRYDVQYDHGNLAGRAHLYTDDKGGYAFWGLTPTPYPIPHDGPVGALLDKTARSPLRAA
FT                   HLHIMATAPGLRTLVTHIFVEGDSLLDSDAVFGVKESLVKRFERQPAGTPAPDGQDLSG
FT                   KSWSRVRFDIVLPPQSA"
     MTTTPAVSDQ QPGTEDELVR TVLASFRNTP DPRLKEVMRA LVLHLHAFIR EVRLTEAEWQ        60
     QAIDFLTAAG HIATDRRQEF VLLSDVLGAS MQTINVNHEA TADATEATVV GPFFVEDSPE       120
     IPLGGDLAAG APGEPCWVEG TVTDTDGNPV PGARLEVWEA DEDGRYDVQY DHGNLAGRAH       180
     LYTDDKGGYA FWGLTPTPYP IPHDGPVGAL LDKTARSPLR AAHLHIMATA PGLRTLVTHI       240
     FVEGDSLLDS DAVFGVKESL VKRFERQPAG TPAPDGQDLS GKSWSRVRFD IVLPPQSA         298
//

If you have problems or comments...

PBIL Back to PBIL home page