(data stored in ACNUC7421 zone)

EMBL: CP002047.PE38

CP002047.PE38        Location/Qualifiers
FT   CDS             complement(35836..36033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03159"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY2"
FT                   /protein_id="ADI03159.1"
FT                   /translation="MDAGVFDVDAGEARSTARSRVRRGVAASGRGWSVSWSAVDGAGRQ
FT                   QDPSGGGVAGRVANQPRFGG"
     MDAGVFDVDA GEARSTARSR VRRGVAASGR GWSVSWSAVD GAGRQQDPSG GGVAGRVANQ        60
     PRFGG                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page