(data stored in ACNUC7421 zone)

EMBL: CP002047.PE380

CP002047.PE380       Location/Qualifiers
FT   CDS             447694..449703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00380"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03501"
FT                   /db_xref="GOA:D7BYH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH3"
FT                   /protein_id="ADI03501.1"
FT                   /translation="MIDGRFELLARLGGGGMGLVWRAHDLALHREVALKEVRPPDPGLA
FT                   EYDPEAARALRARVLREARALARIVHSNVVTIHHIVDGDEHTYPWLVMELVAGGSLQAR
FT                   LDRGLLSPAEAARLGRGMLAGLAAAHAAGIQHRDIKPANILLRPDGSPVLTDFGIAAVQ
FT                   GSTALTAAGSFIGTPDYMAPERVSGEDGGPEADLWSLAMTLYVAVEGRNPMRRGNALAT
FT                   LAAVLGEDVPPPEHAGALTAVLMSVLVRDPQERPDARTLDRLLTEAEAAAESTTAAGQA
FT                   PGAESTMAAGQAPGAESAPMTGSAPTAGSAAAKAPVDDPSSYPLAPPHPAAPQPSRPVP
FT                   QQGEPPAYVAPPSPPMPQTPPMHPPAPPPAARSRRGWVYGSALGAVAVAGALLWALLPL
FT                   GNGSDGDNTARKPDTSGSPDKASNDTPSSGASNGPSGGKKITIGIKFDQPGLGFKTPAG
FT                   RYSGFDVDVATYIAKALGHNPADIEWKETLSSDREAVLERGEVDFIVAAYAVTDAREKK
FT                   VDFAGPYLEAHQDVLIRGDDTSVRTAQDLNGRRVCAPTGSVSALNVRTKFAPQAQVSER
FT                   ATYALCLSDLKDGAVDAVTADDAILAGYAAREPDSFELGGLAMTDERYGIGVAKGSPLK
FT                   DKIQRALDKMTADGSWTRALKQNLPLLKTDAPPQ"
     MIDGRFELLA RLGGGGMGLV WRAHDLALHR EVALKEVRPP DPGLAEYDPE AARALRARVL        60
     REARALARIV HSNVVTIHHI VDGDEHTYPW LVMELVAGGS LQARLDRGLL SPAEAARLGR       120
     GMLAGLAAAH AAGIQHRDIK PANILLRPDG SPVLTDFGIA AVQGSTALTA AGSFIGTPDY       180
     MAPERVSGED GGPEADLWSL AMTLYVAVEG RNPMRRGNAL ATLAAVLGED VPPPEHAGAL       240
     TAVLMSVLVR DPQERPDART LDRLLTEAEA AAESTTAAGQ APGAESTMAA GQAPGAESAP       300
     MTGSAPTAGS AAAKAPVDDP SSYPLAPPHP AAPQPSRPVP QQGEPPAYVA PPSPPMPQTP       360
     PMHPPAPPPA ARSRRGWVYG SALGAVAVAG ALLWALLPLG NGSDGDNTAR KPDTSGSPDK       420
     ASNDTPSSGA SNGPSGGKKI TIGIKFDQPG LGFKTPAGRY SGFDVDVATY IAKALGHNPA       480
     DIEWKETLSS DREAVLERGE VDFIVAAYAV TDAREKKVDF AGPYLEAHQD VLIRGDDTSV       540
     RTAQDLNGRR VCAPTGSVSA LNVRTKFAPQ AQVSERATYA LCLSDLKDGA VDAVTADDAI       600
     LAGYAAREPD SFELGGLAMT DERYGIGVAK GSPLKDKIQR ALDKMTADGS WTRALKQNLP       660
     LLKTDAPPQ                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page