(data stored in ACNUC7421 zone)

EMBL: CP002047.PE382

CP002047.PE382       Location/Qualifiers
FT   CDS             450531..450839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03503"
FT                   /db_xref="GOA:D7BYH5"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH5"
FT                   /protein_id="ADI03503.1"
FT                   /translation="MTGTKADDPGFASASLPRHLVRGAVGFGALVGSFALIPAVGPVSL
FT                   VLLPAGLFALRGCPMCWAVGLIQTISRGRLERSCEDGQCTLTVADHGKRHGESVAAP"
     MTGTKADDPG FASASLPRHL VRGAVGFGAL VGSFALIPAV GPVSLVLLPA GLFALRGCPM        60
     CWAVGLIQTI SRGRLERSCE DGQCTLTVAD HGKRHGESVA AP                          102
//

If you have problems or comments...

PBIL Back to PBIL home page