(data stored in ACNUC7421 zone)

EMBL: CP002047.PE383

CP002047.PE383       Location/Qualifiers
FT   CDS             450892..451863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00383"
FT                   /product="WD-40 repeat protein"
FT                   /note="COG2319 FOG: WD40 repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03504"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH6"
FT                   /protein_id="ADI03504.1"
FT                   /translation="MSDERLILSSVAPGGPVHGLAVVDVDGEPLVVCTGFYKLWTWAPL
FT                   RDEWLERPLASAFAAEYPDAENDIDSVAVAVFDGRVVLAAGGDEQGASIWDLFSGELLR
FT                   GNTHNGPYIASIATVKNAGPPLFVASSGIHWDGVELWGLGEEPPIELDAGSVWGLATAR
FT                   IDGRSLVAGGNEEGVTVWDVANGEEVASFYVDDEQRSYAVGFSEVDGRPVVVAGTDSGK
FT                   VYVFDLAAGEDDDPIHEPATGHEGGINALDIAVVGDRPVAVTGGEDGTVRIWDLAGGRP
FT                   VGPPLTGHDARVEAVAVTTLRDRPVALTAGRDGAVRVWDLAL"
     MSDERLILSS VAPGGPVHGL AVVDVDGEPL VVCTGFYKLW TWAPLRDEWL ERPLASAFAA        60
     EYPDAENDID SVAVAVFDGR VVLAAGGDEQ GASIWDLFSG ELLRGNTHNG PYIASIATVK       120
     NAGPPLFVAS SGIHWDGVEL WGLGEEPPIE LDAGSVWGLA TARIDGRSLV AGGNEEGVTV       180
     WDVANGEEVA SFYVDDEQRS YAVGFSEVDG RPVVVAGTDS GKVYVFDLAA GEDDDPIHEP       240
     ATGHEGGINA LDIAVVGDRP VAVTGGEDGT VRIWDLAGGR PVGPPLTGHD ARVEAVAVTT       300
     LRDRPVALTA GRDGAVRVWD LAL                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page