(data stored in ACNUC7421 zone)

EMBL: CP002047.PE385

CP002047.PE385       Location/Qualifiers
FT   CDS             complement(452089..452592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00385"
FT                   /product="transcriptional regulator, MarR family protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03506"
FT                   /db_xref="GOA:D7BYH8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH8"
FT                   /protein_id="ADI03506.1"
FT                   /translation="MAENNEDGPAVEELLGARLGYLLKHAQLRLAEHAGPALARFGLDA
FT                   RELAVLAVLAAGRPLSQLEAARRLGVDRTTMVALIDALESKDLVERRRSEEDRRRNVVE
FT                   LTERGMRVRADAEEAREAAEREFLGPLGEEEAARLMKALRVLVLRTPNQPLAPRGQAAR
FT                   SGRS"
     MAENNEDGPA VEELLGARLG YLLKHAQLRL AEHAGPALAR FGLDARELAV LAVLAAGRPL        60
     SQLEAARRLG VDRTTMVALI DALESKDLVE RRRSEEDRRR NVVELTERGM RVRADAEEAR       120
     EAAEREFLGP LGEEEAARLM KALRVLVLRT PNQPLAPRGQ AARSGRS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page