(data stored in ACNUC7421 zone)

EMBL: CP002047.PE386

CP002047.PE386       Location/Qualifiers
FT   CDS             452642..453565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00386"
FT                   /product="hypothetical protein"
FT                   /note="COG2141 Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase and related
FT                   flavin-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03507"
FT                   /db_xref="GOA:D7BYH9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYH9"
FT                   /protein_id="ADI03507.1"
FT                   /translation="MVTVMAIDTPLRALRFGVKTTPMHLGYDEILRVWEEADELPELDD
FT                   AWLWDHLMPLAGPPGGAVLEGWTLLAALAARTSRLRLGLLVTSNRLRAPAHLGKIATTV
FT                   DAISQGRLIMGLGVGGTRQPDGPNPAVAEYAAYGLPLPSPGEGLARLTETITILRRMWS
FT                   EEVFDHDGPFTTLRATRNGPGPVQPGGPPLLLGGWGDRTLRIIAEHADIWNVPGPPHNA
FT                   TDWIAARARVLDAHCEAIGRDPAEITRSAQIIVDYTDPAATRAHVHALAAAGIRHIVLA
FT                   LPRPYRDKAARWLVDEIITPVRERGA"
     MVTVMAIDTP LRALRFGVKT TPMHLGYDEI LRVWEEADEL PELDDAWLWD HLMPLAGPPG        60
     GAVLEGWTLL AALAARTSRL RLGLLVTSNR LRAPAHLGKI ATTVDAISQG RLIMGLGVGG       120
     TRQPDGPNPA VAEYAAYGLP LPSPGEGLAR LTETITILRR MWSEEVFDHD GPFTTLRATR       180
     NGPGPVQPGG PPLLLGGWGD RTLRIIAEHA DIWNVPGPPH NATDWIAARA RVLDAHCEAI       240
     GRDPAEITRS AQIIVDYTDP AATRAHVHAL AAAGIRHIVL ALPRPYRDKA ARWLVDEIIT       300
     PVRERGA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page