(data stored in ACNUC7421 zone)

EMBL: CP002047.PE389

CP002047.PE389       Location/Qualifiers
FT   CDS             455418..456677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00389"
FT                   /product="putative N-carbamoyl-L-amino acid amidohydrolase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03510"
FT                   /db_xref="GOA:D7BYI2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI2"
FT                   /protein_id="ADI03510.1"
FT                   /translation="MTIEHTATSPDAELFLRDFRSLSQIGETPGGGVDRQAATVADAQA
FT                   RAWFTALLGQYGFTVEVDAVGNVFGLLEWNPGAPYVLVGSHLDSQPLAGKFDGAYGVAA
FT                   ALHAGRRLAAGHAPAHRPKYNLAVVDWFNEEGSRFAPSMMGSSVFTGKMAAADALAIRD
FT                   TDGVSVAEALAAIGHTGSGTGPVPAACAEIHIEQGRSLEDSDTTIGLVHSCWAAEKFTV
FT                   TVHGEQAHTGSTVIADRRDALLGASRLVVLLRELADRYPAGALHTSVGQLTVLPNSPVV
FT                   VPRRVDLTMDLRSADEDVLAEAKQLLEQGIKLIEDEVRVRIEVRGSHAWGVRPYPAAGV
FT                   DLARDCADSLGLTSRPVYTLAGHDSINMNDVVPTVMLFVPSREGVSHNEGEFTGDSDLC
FT                   AGVDVLTEVVRRLCEGALDG"
     MTIEHTATSP DAELFLRDFR SLSQIGETPG GGVDRQAATV ADAQARAWFT ALLGQYGFTV        60
     EVDAVGNVFG LLEWNPGAPY VLVGSHLDSQ PLAGKFDGAY GVAAALHAGR RLAAGHAPAH       120
     RPKYNLAVVD WFNEEGSRFA PSMMGSSVFT GKMAAADALA IRDTDGVSVA EALAAIGHTG       180
     SGTGPVPAAC AEIHIEQGRS LEDSDTTIGL VHSCWAAEKF TVTVHGEQAH TGSTVIADRR       240
     DALLGASRLV VLLRELADRY PAGALHTSVG QLTVLPNSPV VVPRRVDLTM DLRSADEDVL       300
     AEAKQLLEQG IKLIEDEVRV RIEVRGSHAW GVRPYPAAGV DLARDCADSL GLTSRPVYTL       360
     AGHDSINMND VVPTVMLFVP SREGVSHNEG EFTGDSDLCA GVDVLTEVVR RLCEGALDG        419
//

If you have problems or comments...

PBIL Back to PBIL home page