(data stored in ACNUC7421 zone)

EMBL: CP002047.PE392

CP002047.PE392       Location/Qualifiers
FT   CDS             complement(459323..460534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00392"
FT                   /product="putative transcriptional regulator, PucR family
FT                   protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03513"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYI5"
FT                   /protein_id="ADI03513.1"
FT                   /translation="MSPDEDKATMEHLQTPHPALPPADPHVAALASQCLEEIDSLVSEW
FT                   AEYVGPVRASYSDLVSPQDFRDSAWQAFELLLRTVAQLPVPEHIAGVSERVGEQRARQG
FT                   VPLDALLQAARVDFRVVWAALVRRAGEEGRAQLVTSAYYVWEAVERHVTGIMTTYQRTV
FT                   LEMGRRREDERRLWFTRLLDSDGRNPTVVQDAALALGFQVSGRFLCAVAPGGGEASLRG
FT                   AANALRNLGTPMQQQAVASDMVLVVQLGSRVARETVLAHLLGTPCGVSPEVTGVTEVPR
FT                   AVKLATATARVLPRDATGPRRLEDSWLDVLVHRAGDLGRDLAADVLGGLHEAVPRVEAD
FT                   RLLETVRVHLSGSGSVADTAAALYCHRNTIQQRLNRFAELTGRDPRRPEDAALVVLALS
FT                   AGRL"
     MSPDEDKATM EHLQTPHPAL PPADPHVAAL ASQCLEEIDS LVSEWAEYVG PVRASYSDLV        60
     SPQDFRDSAW QAFELLLRTV AQLPVPEHIA GVSERVGEQR ARQGVPLDAL LQAARVDFRV       120
     VWAALVRRAG EEGRAQLVTS AYYVWEAVER HVTGIMTTYQ RTVLEMGRRR EDERRLWFTR       180
     LLDSDGRNPT VVQDAALALG FQVSGRFLCA VAPGGGEASL RGAANALRNL GTPMQQQAVA       240
     SDMVLVVQLG SRVARETVLA HLLGTPCGVS PEVTGVTEVP RAVKLATATA RVLPRDATGP       300
     RRLEDSWLDV LVHRAGDLGR DLAADVLGGL HEAVPRVEAD RLLETVRVHL SGSGSVADTA       360
     AALYCHRNTI QQRLNRFAEL TGRDPRRPED AALVVLALSA GRL                         403
//

If you have problems or comments...

PBIL Back to PBIL home page