(data stored in ACNUC7421 zone)

EMBL: CP002047.PE398

CP002047.PE398       Location/Qualifiers
FT   CDS             468922..470592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00398"
FT                   /product="hypothetical protein"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03519"
FT                   /db_xref="GOA:D7BYJ1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ1"
FT                   /protein_id="ADI03519.1"
FT                   /translation="MTFLREAISRIGTTLDLGHTARVLVTSAVPRFADFASVHLHDHVT
FT                   AQDDASVPQQPPGSVVMHRVASAHTDDPGAGELHAERTFVYQADTAMARFLALVEPILI
FT                   PRVDQDTLRQLPQELDSPAARSVLSGSSVMLVPLTVRGLVLGFMVFGRKPERLAFSPVD
FT                   LAACQEMAEQAALSLDNARLYGHEARTSAVLQRSLLPTRPPRLPSVEIAYRYHPCSRTT
FT                   QVGGDWLDVIPLPRHRVGLVIGDVAGHGLHAAVAMGQLRTAVRTLATMDLPPAQLLAHL
FT                   DQLAQHLGHVPLTTCLYAIYDPIAGRAAFASAGHLPPVLLRPDGTDELLEIPVGAPIGV
FT                   GSIAFDTLDVSIDSGSLLVLYTDGLVEARGHDIEEGLLAVRCGLAATHPSLDEACESLL
FT                   RQQHPNGDHDDIAVLMARLHSIPDDKVATWRFPPQPQQVSVARRRVRDTLTAWGLDPLC
FT                   DTTELLAGELLTNAIRHTTHPVGLRLVHTDTLLCEVTGDQQITPMLPHTPGTQASHCAI
FT                   TLLQKLATRWGCSDTSTGRTVWFESNLPAPASRATARRL"
     MTFLREAISR IGTTLDLGHT ARVLVTSAVP RFADFASVHL HDHVTAQDDA SVPQQPPGSV        60
     VMHRVASAHT DDPGAGELHA ERTFVYQADT AMARFLALVE PILIPRVDQD TLRQLPQELD       120
     SPAARSVLSG SSVMLVPLTV RGLVLGFMVF GRKPERLAFS PVDLAACQEM AEQAALSLDN       180
     ARLYGHEART SAVLQRSLLP TRPPRLPSVE IAYRYHPCSR TTQVGGDWLD VIPLPRHRVG       240
     LVIGDVAGHG LHAAVAMGQL RTAVRTLATM DLPPAQLLAH LDQLAQHLGH VPLTTCLYAI       300
     YDPIAGRAAF ASAGHLPPVL LRPDGTDELL EIPVGAPIGV GSIAFDTLDV SIDSGSLLVL       360
     YTDGLVEARG HDIEEGLLAV RCGLAATHPS LDEACESLLR QQHPNGDHDD IAVLMARLHS       420
     IPDDKVATWR FPPQPQQVSV ARRRVRDTLT AWGLDPLCDT TELLAGELLT NAIRHTTHPV       480
     GLRLVHTDTL LCEVTGDQQI TPMLPHTPGT QASHCAITLL QKLATRWGCS DTSTGRTVWF       540
     ESNLPAPASR ATARRL                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page