(data stored in ACNUC7421 zone)

EMBL: CP002047.PE400

CP002047.PE400       Location/Qualifiers
FT   CDS             471137..471541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03521"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ3"
FT                   /protein_id="ADI03521.1"
FT                   /translation="MAWLPGRVGTVCRAGSTSGWSPQAATADTTASRTAMDTNCAVSGM
FT                   LRGRRGDSGQPARDGADAADGVHGVEHRAAVLLLDGDRLGVHRHGRTPSALTVRLPRRR
FT                   TSSPPAWLPASAPSSLSNTGFGQIFGVRRW"
     MAWLPGRVGT VCRAGSTSGW SPQAATADTT ASRTAMDTNC AVSGMLRGRR GDSGQPARDG        60
     ADAADGVHGV EHRAAVLLLD GDRLGVHRHG RTPSALTVRL PRRRTSSPPA WLPASAPSSL       120
     SNTGFGQIFG VRRW                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page