(data stored in ACNUC7421 zone)

EMBL: CP002047.PE401

CP002047.PE401       Location/Qualifiers
FT   CDS             complement(471528..472442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00401"
FT                   /product="NmrA family protein"
FT                   /note="COG0702 Predicted nucleoside-diphosphate-sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03522"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ4"
FT                   /protein_id="ADI03522.1"
FT                   /translation="MTTETPANPDSPILVTGATGKQGGATARRLLAGGWPVRALVRDLT
FT                   APGAAELAAAGAQLVRGDFDDPASLRPALDGAAAVFGIPPVSYGPTGPETELEAARGRT
FT                   LIDAAAAAGIEQIVFSTVASSSAASWSWEGKTLIEEYLRDHIALPTVLRPVRFMTNYLS
FT                   VGAIGIDGISRGVHRHLFPPHEPMQIIALEDIAEFAALAFADPARFAGRTLELAGDEPT
FT                   PVEAAAAIAEATGAPIRYEQLTDGEAAALGPEIAETKKRWEAGHRWHADIEALRVIHPG
FT                   LRTLTDWLTESGAAAIRARLTTS"
     MTTETPANPD SPILVTGATG KQGGATARRL LAGGWPVRAL VRDLTAPGAA ELAAAGAQLV        60
     RGDFDDPASL RPALDGAAAV FGIPPVSYGP TGPETELEAA RGRTLIDAAA AAGIEQIVFS       120
     TVASSSAASW SWEGKTLIEE YLRDHIALPT VLRPVRFMTN YLSVGAIGID GISRGVHRHL       180
     FPPHEPMQII ALEDIAEFAA LAFADPARFA GRTLELAGDE PTPVEAAAAI AEATGAPIRY       240
     EQLTDGEAAA LGPEIAETKK RWEAGHRWHA DIEALRVIHP GLRTLTDWLT ESGAAAIRAR       300
     LTTS                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page