(data stored in ACNUC7421 zone)

EMBL: CP002047.PE402

CP002047.PE402       Location/Qualifiers
FT   CDS             472659..473303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00402"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03523"
FT                   /db_xref="GOA:D7BYJ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ5"
FT                   /protein_id="ADI03523.1"
FT                   /translation="MSLGRIAQRAGVGAGTVYRHFPTKEILIEAVLAEHVERLVTAADR
FT                   WAARAAPGDALFGFLLEVAEQSMGRRHFCDALAADQSWPRAVLAAAGQRFRQALGRLLY
FT                   DAKEAGAVRTDVQADDLSALVAGGVALRSAHRDPARGTWLVRLLLDGLRTHPVTKADPF
FT                   RDSSALPRHETTPLKYCVECGATLRVHATGRPPRYCGPTCRQRAHRRRPAA"
     MSLGRIAQRA GVGAGTVYRH FPTKEILIEA VLAEHVERLV TAADRWAARA APGDALFGFL        60
     LEVAEQSMGR RHFCDALAAD QSWPRAVLAA AGQRFRQALG RLLYDAKEAG AVRTDVQADD       120
     LSALVAGGVA LRSAHRDPAR GTWLVRLLLD GLRTHPVTKA DPFRDSSALP RHETTPLKYC       180
     VECGATLRVH ATGRPPRYCG PTCRQRAHRR RPAA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page