(data stored in ACNUC7421 zone)

EMBL: CP002047.PE404

CP002047.PE404       Location/Qualifiers
FT   CDS             474093..474797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00404"
FT                   /product="response regulator receiver"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03525"
FT                   /db_xref="GOA:D7BYJ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ7"
FT                   /protein_id="ADI03525.1"
FT                   /translation="MTASERLLVVEDEPTLRELLSASLRLAGFAVAPVATGAQALAAVR
FT                   EQRPDLIVLDVMLPDFDGFEVVRRLRGQHPSAAAGHPPVLFLTARDAPEDRISGLRAGG
FT                   DDYVTKPFNLEELVLRIRAILRRTSGRQADGRLVVGMLELDPDSHQVTRDGRPVQLSPT
FT                   EFSLLRVLMENAGQVLSKSQLLELVWQYDFGGDDSIVASYISYLRRKVDLDEPKLIHTV
FT                   RGTGYVLRRPRQ"
     MTASERLLVV EDEPTLRELL SASLRLAGFA VAPVATGAQA LAAVREQRPD LIVLDVMLPD        60
     FDGFEVVRRL RGQHPSAAAG HPPVLFLTAR DAPEDRISGL RAGGDDYVTK PFNLEELVLR       120
     IRAILRRTSG RQADGRLVVG MLELDPDSHQ VTRDGRPVQL SPTEFSLLRV LMENAGQVLS       180
     KSQLLELVWQ YDFGGDDSIV ASYISYLRRK VDLDEPKLIH TVRGTGYVLR RPRQ             234
//

If you have problems or comments...

PBIL Back to PBIL home page