(data stored in ACNUC7421 zone)

EMBL: CP002047.PE405

CP002047.PE405       Location/Qualifiers
FT   CDS             474794..476359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00405"
FT                   /product="histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03526"
FT                   /db_xref="GOA:D7BYJ8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ8"
FT                   /protein_id="ADI03526.1"
FT                   /translation="MNKSPLRKSRFSLRGGLSLRGRFSLRGRFSLRGRLLAISLLLLVV
FT                   ALLGSNALVVTLLQRDLVHRLDDRLRAAATATTRLTDPSGAAGDQAPQLRATVEQHLTG
FT                   DSYLAYLGSNGRVRRVIRPAVHSAPVLPPLDATAVRERDRRPFEAPAVDGDESWRVLAV
FT                   PLNATGRARKGPKARAADTHSVVVAGSLAEVDSTITQLGARMLVIDSLVLALLGVAGWF
FT                   AVRAGLRPLRRIETTAAAIADGDLSSRVPELAASRTELGRLATALNGMLDRIEASDAAR
FT                   AAAAELMRRFIADASHELRTPLFGIKGFTELYRMGGMPERTDVDAAMSRIEREAARLVR
FT                   LVEDLLLLARLDEHAAAADLPLRLTPMDLRTLAADALHDLRALDPLRPVTLTGPGGGPP
FT                   GGAPVLGDEARLRQVTSNLVGNAVAHTPPGTPVRIGVGVGAEDGLAVLELQDEGPGMSQ
FT                   EQAARAFDRFYRADDARGRTESGGAGLGLAIVASLVTAHHGRVEVRTAPGEGATFRVLL
FT                   PLHG"
     MNKSPLRKSR FSLRGGLSLR GRFSLRGRFS LRGRLLAISL LLLVVALLGS NALVVTLLQR        60
     DLVHRLDDRL RAAATATTRL TDPSGAAGDQ APQLRATVEQ HLTGDSYLAY LGSNGRVRRV       120
     IRPAVHSAPV LPPLDATAVR ERDRRPFEAP AVDGDESWRV LAVPLNATGR ARKGPKARAA       180
     DTHSVVVAGS LAEVDSTITQ LGARMLVIDS LVLALLGVAG WFAVRAGLRP LRRIETTAAA       240
     IADGDLSSRV PELAASRTEL GRLATALNGM LDRIEASDAA RAAAAELMRR FIADASHELR       300
     TPLFGIKGFT ELYRMGGMPE RTDVDAAMSR IEREAARLVR LVEDLLLLAR LDEHAAAADL       360
     PLRLTPMDLR TLAADALHDL RALDPLRPVT LTGPGGGPPG GAPVLGDEAR LRQVTSNLVG       420
     NAVAHTPPGT PVRIGVGVGA EDGLAVLELQ DEGPGMSQEQ AARAFDRFYR ADDARGRTES       480
     GGAGLGLAIV ASLVTAHHGR VEVRTAPGEG ATFRVLLPLH G                           521
//

If you have problems or comments...

PBIL Back to PBIL home page