(data stored in ACNUC7421 zone)

EMBL: CP002047.PE407

CP002047.PE407       Location/Qualifiers
FT   CDS             complement(478133..479767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00407"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03528"
FT                   /db_xref="GOA:D7BYK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK0"
FT                   /protein_id="ADI03528.1"
FT                   /translation="MSDAAIVCSNVSFTWPDDTPVFQDLSVTVGTGRTGLVAPNGSGKS
FT                   TLLKLIAGELRPGAGSVSLQGTLGYLPQSLPLTGELTVAEVLGVAAVIRAIDAVESGDV
FT                   DEKHFTTIGDDWDIEERTRAQLDRLGLTDLTLDRRLGTLSGGQVVSLGLAAQLLKRPDV
FT                   LLLDEPTNNLDLDARHKLYDVLGDFNGCLLLVSHDRALLDRMERIAELDSDELRFHGGN
FT                   FTEYEEAVRAEQEVAEKNLRSAEQELKREKREMQQARERAERRAGNAARNLKNAGLPRI
FT                   FAGNMKRGAQESAGRAGQMHASRVSEAKSRVDEAGRALRDEQRITLDLPDTVVPAGRTL
FT                   FLGEAMQVRHGERPVFTGKGVDLTIRGPERIALTGTNGAGKSTLLRLINGDPAMDSGEI
FT                   KRADGRIAYLSQRLDVLDRSRTVAENFAAFAPQRPQAERMNLLARFLFRGARAHLPVGV
FT                   LSGGELLRATLACVLCAEPAPQLLLLDEPTNNLDLVSVAQLESALGSYQGAFVVVSHDE
FT                   RFLAETGVDRWLRLADGELTETGAPQR"
     MSDAAIVCSN VSFTWPDDTP VFQDLSVTVG TGRTGLVAPN GSGKSTLLKL IAGELRPGAG        60
     SVSLQGTLGY LPQSLPLTGE LTVAEVLGVA AVIRAIDAVE SGDVDEKHFT TIGDDWDIEE       120
     RTRAQLDRLG LTDLTLDRRL GTLSGGQVVS LGLAAQLLKR PDVLLLDEPT NNLDLDARHK       180
     LYDVLGDFNG CLLLVSHDRA LLDRMERIAE LDSDELRFHG GNFTEYEEAV RAEQEVAEKN       240
     LRSAEQELKR EKREMQQARE RAERRAGNAA RNLKNAGLPR IFAGNMKRGA QESAGRAGQM       300
     HASRVSEAKS RVDEAGRALR DEQRITLDLP DTVVPAGRTL FLGEAMQVRH GERPVFTGKG       360
     VDLTIRGPER IALTGTNGAG KSTLLRLING DPAMDSGEIK RADGRIAYLS QRLDVLDRSR       420
     TVAENFAAFA PQRPQAERMN LLARFLFRGA RAHLPVGVLS GGELLRATLA CVLCAEPAPQ       480
     LLLLDEPTNN LDLVSVAQLE SALGSYQGAF VVVSHDERFL AETGVDRWLR LADGELTETG       540
     APQR                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page