(data stored in ACNUC7421 zone)

EMBL: CP002047.PE408

CP002047.PE408       Location/Qualifiers
FT   CDS             480208..482514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03529"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK1"
FT                   /protein_id="ADI03529.1"
FT                   /translation="MNLRQSRLRRSAHSAALVAATFTLASGVAVTLPSATAHAADATEV
FT                   VIPSPDAYADRAERLLSTGDTGVLHQEQGSTSYLWTNTYNRQTVPVKALDGVPRESIFS
FT                   SHDQSNRVAYATTDADGATTITLLNVDQNTKSTLRLPDGYAHPQVYGGFALATRTLEDG
FT                   TYELRVLRARAGDTPYDVQVQLPADATAESEPVVLGGESTSLLIRYRTGSTHGYGILNG
FT                   ITGAVAPLPVTGEASSFRLTRDTVTWFSRQDEQGVRVLPRDGSTTTPRVVALTPQSADS
FT                   EITAYTVGRNVLWHEGDRGPLRLTPIDGAETSRVLLTDIEQGLQGSNSTLTALGRDADG
FT                   TRAIHRFTVDGSGLVFDQQLRVVAPVTVAYGSIQALGLDRGTVRYVNALQQTQRLHGKD
FT                   IGASLDPSAGDDLPVHGDSAPGRFADGGDEGLARLVADPDNGGKDVLVTGDDPDQPVDR
FT                   LPLPATDGRILDVSPEYVLYESQGPYKRQYVIDIVRDRIVKEQAPQAAALDYTTLWTPS
FT                   PDRPGTVIATDLRTGKQTDTVTLGASCTPEELQSNGTLLYWSCPEQGEAGVQDPASGLT
FT                   YPAPADEVLLGDGFIAGHNAVDGALSLTGLNEDGTTTDLGSVLALKPTSATDSRGITWT
FT                   VDRRAGKLAYVDRAETVHVFAPQHDVSALSVPDRSVPATWDRGEETAAWNAQWWLSKPA
FT                   ASWKLTLHNEDTDAEVRTWSGDSTASTVKASWDGTTTDGATAPDGAYTWTLTATPADGR
FT                   GDPVTVSGTLTVNGS"
     MNLRQSRLRR SAHSAALVAA TFTLASGVAV TLPSATAHAA DATEVVIPSP DAYADRAERL        60
     LSTGDTGVLH QEQGSTSYLW TNTYNRQTVP VKALDGVPRE SIFSSHDQSN RVAYATTDAD       120
     GATTITLLNV DQNTKSTLRL PDGYAHPQVY GGFALATRTL EDGTYELRVL RARAGDTPYD       180
     VQVQLPADAT AESEPVVLGG ESTSLLIRYR TGSTHGYGIL NGITGAVAPL PVTGEASSFR       240
     LTRDTVTWFS RQDEQGVRVL PRDGSTTTPR VVALTPQSAD SEITAYTVGR NVLWHEGDRG       300
     PLRLTPIDGA ETSRVLLTDI EQGLQGSNST LTALGRDADG TRAIHRFTVD GSGLVFDQQL       360
     RVVAPVTVAY GSIQALGLDR GTVRYVNALQ QTQRLHGKDI GASLDPSAGD DLPVHGDSAP       420
     GRFADGGDEG LARLVADPDN GGKDVLVTGD DPDQPVDRLP LPATDGRILD VSPEYVLYES       480
     QGPYKRQYVI DIVRDRIVKE QAPQAAALDY TTLWTPSPDR PGTVIATDLR TGKQTDTVTL       540
     GASCTPEELQ SNGTLLYWSC PEQGEAGVQD PASGLTYPAP ADEVLLGDGF IAGHNAVDGA       600
     LSLTGLNEDG TTTDLGSVLA LKPTSATDSR GITWTVDRRA GKLAYVDRAE TVHVFAPQHD       660
     VSALSVPDRS VPATWDRGEE TAAWNAQWWL SKPAASWKLT LHNEDTDAEV RTWSGDSTAS       720
     TVKASWDGTT TDGATAPDGA YTWTLTATPA DGRGDPVTVS GTLTVNGS                    768
//

If you have problems or comments...

PBIL Back to PBIL home page