(data stored in ACNUC7421 zone)

EMBL: CP002047.PE409

CP002047.PE409       Location/Qualifiers
FT   CDS             complement(482615..483274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00409"
FT                   /product="two-component system response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03530"
FT                   /db_xref="GOA:D7BYK2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK2"
FT                   /protein_id="ADI03530.1"
FT                   /translation="MTAPIRVLVCDDQVLVRTGLVTIIDAQPDLEVVGECEDGQAAVDL
FT                   AGRLRPEVVVMDVRMPVLDGIEATRLLAGAGVPHPVKVLVVTTFNLDKYVYEALRAGAS
FT                   GFLLKEAPPSQLLHGIRTVATGAALLDPEVTRRLVGTYVARIRPAEDTSRDIPLTPREL
FT                   EVLRLIADGFSNSEIAAALQISPETVKTFVSRILTKLDLRDRVQAVVYAYRQGLVT"
     MTAPIRVLVC DDQVLVRTGL VTIIDAQPDL EVVGECEDGQ AAVDLAGRLR PEVVVMDVRM        60
     PVLDGIEATR LLAGAGVPHP VKVLVVTTFN LDKYVYEALR AGASGFLLKE APPSQLLHGI       120
     RTVATGAALL DPEVTRRLVG TYVARIRPAE DTSRDIPLTP RELEVLRLIA DGFSNSEIAA       180
     ALQISPETVK TFVSRILTKL DLRDRVQAVV YAYRQGLVT                              219
//

If you have problems or comments...

PBIL Back to PBIL home page