(data stored in ACNUC7421 zone)

EMBL: CP002047.PE41

CP002047.PE41        Location/Qualifiers
FT   CDS             37318..38274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00041"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /note="COG4977 Transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03162"
FT                   /db_xref="GOA:D7BSY5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY5"
FT                   /protein_id="ADI03162.1"
FT                   /translation="MPSSRLRRVAVLVLEGAKPLDVGIPAQVFTTRASMPYEVRVCGAA
FT                   PGLVTGGDGLAYHVTHGLDALGWADIVFVPGYRFPDRDDPPRAVVDALIAAHDRGARLA
FT                   AISTGAFALAATGRLDGKRATTHWHYTRALAQKHPLIRVDENVLFVDEGSVLTSAGAAS
FT                   GIDLCLHILRGDLGVAASNHAARRLVAAPYRSGGQAQYVPRSVPEPLGERFAATREWAL
FT                   HRLDEPLSLESLAQHAAVSPRTFSRRFVEDTGYTPMQWVMRARIDLARELLERSKRSVE
FT                   QIANDVGLGTGANLRMHFQHILGTTPSEYRRTFTRGE"
     MPSSRLRRVA VLVLEGAKPL DVGIPAQVFT TRASMPYEVR VCGAAPGLVT GGDGLAYHVT        60
     HGLDALGWAD IVFVPGYRFP DRDDPPRAVV DALIAAHDRG ARLAAISTGA FALAATGRLD       120
     GKRATTHWHY TRALAQKHPL IRVDENVLFV DEGSVLTSAG AASGIDLCLH ILRGDLGVAA       180
     SNHAARRLVA APYRSGGQAQ YVPRSVPEPL GERFAATREW ALHRLDEPLS LESLAQHAAV       240
     SPRTFSRRFV EDTGYTPMQW VMRARIDLAR ELLERSKRSV EQIANDVGLG TGANLRMHFQ       300
     HILGTTPSEY RRTFTRGE                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page