(data stored in ACNUC7421 zone)

EMBL: CP002047.PE410

CP002047.PE410       Location/Qualifiers
FT   CDS             complement(483271..484401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00410"
FT                   /product="putative two-component system sensor kinase"
FT                   /note="COG3851 Signal transduction histidine kinase,
FT                   glucose-6-phosphate specific"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03531"
FT                   /db_xref="GOA:D7BYK3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK3"
FT                   /protein_id="ADI03531.1"
FT                   /translation="MDVTVRDLPLGLLILAASLLPASQNHGTQLGGLTARPFDALAIVA
FT                   VALQCLPLALRRRWPVVCLSLVSLGFAVDQLRGYHSLAGTAMPIALLTAGSHLERHRRA
FT                   TVFLFSAAYVPLAVALYQLGSGEPPSEFVMYYVALALAWGIGGWLRSTRAAEAERRRRV
FT                   AEDTRTAERARIARELHDVVTHHVTAMVVQAEAARYLTAAPDRLDQALTAVTDAGRRAT
FT                   ADLRHLLDLINPDHGSGPARTPPVGRLLTLVEQTRRAGQPVEFTEEGTPAESTGSADLV
FT                   AYRVVQEALTNALKYAHGIRTSVQVHHGEKGITVEVSTDGSGSPAGSRTGSLGGSGRGL
FT                   AGLRERVDVLGGDFSAGARTGGGFVVRARIPAGSPS"
     MDVTVRDLPL GLLILAASLL PASQNHGTQL GGLTARPFDA LAIVAVALQC LPLALRRRWP        60
     VVCLSLVSLG FAVDQLRGYH SLAGTAMPIA LLTAGSHLER HRRATVFLFS AAYVPLAVAL       120
     YQLGSGEPPS EFVMYYVALA LAWGIGGWLR STRAAEAERR RRVAEDTRTA ERARIARELH       180
     DVVTHHVTAM VVQAEAARYL TAAPDRLDQA LTAVTDAGRR ATADLRHLLD LINPDHGSGP       240
     ARTPPVGRLL TLVEQTRRAG QPVEFTEEGT PAESTGSADL VAYRVVQEAL TNALKYAHGI       300
     RTSVQVHHGE KGITVEVSTD GSGSPAGSRT GSLGGSGRGL AGLRERVDVL GGDFSAGART       360
     GGGFVVRARI PAGSPS                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page