(data stored in ACNUC7421 zone)

EMBL: CP002047.PE413

CP002047.PE413       Location/Qualifiers
FT   CDS             486541..487143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00413"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03534"
FT                   /db_xref="GOA:D7BYK6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK6"
FT                   /protein_id="ADI03534.1"
FT                   /translation="MKTQRESTPARSRPLRADAERTVTAILEAAERTLSRDPAATMEQI
FT                   AEAAGVARTTVHRRFATREALIDALAGWATERFAAAVDAAHPDTAPPLVALYQTTANVL
FT                   GVKVSWGFAMSQASSVNPEVARVHSGVRDTCERLFRRAQEAGVLRADIDIPWTRRVYYA
FT                   LIHEAAQNRNEQDTATLATLVVDTLLRGAGTPHPDRL"
     MKTQRESTPA RSRPLRADAE RTVTAILEAA ERTLSRDPAA TMEQIAEAAG VARTTVHRRF        60
     ATREALIDAL AGWATERFAA AVDAAHPDTA PPLVALYQTT ANVLGVKVSW GFAMSQASSV       120
     NPEVARVHSG VRDTCERLFR RAQEAGVLRA DIDIPWTRRV YYALIHEAAQ NRNEQDTATL       180
     ATLVVDTLLR GAGTPHPDRL                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page