(data stored in ACNUC7421 zone)

EMBL: CP002047.PE414

CP002047.PE414       Location/Qualifiers
FT   CDS             complement(487171..488910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00414"
FT                   /product="hypothetical protein"
FT                   /note="COG1626 Neutral trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03535"
FT                   /db_xref="GOA:D7BYK7"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR004888"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK7"
FT                   /protein_id="ADI03535.1"
FT                   /translation="MTAARPGPAFSLHDIPFSAYGSWFGISPVLAEQTHAEDLHLVSHQ
FT                   NGMHAVLRLVPLDPTTGGRADTRVTATPSLLSWRNDHGRIDLAYESPDTVRLRGKGTAL
FT                   RVSAAAPTLTPFTGTYFFRDPAAGAYVFTSYETGRRYRLTVLSGAVRDASGGQALGSAD
FT                   RGLTITADHGHGGTWEAAIEEFDSGRRPYSSARATFDEVVAAAERAFADFADTVAPWRS
FT                   SRTPAAELAAYVLWSATVAPAGLVTRPAVLMSKHWMDKVWSWDHCFNALALAPGAPALA
FT                   WDQFSLPFDHQDESGALPDSVTHSEVLYNFVKPPIHGWTLAHLRRRLPEPLGHAELTAT
FT                   YDRLRRWTDFWLTARRAPGATLPHYQHGNDSGWDNATTFDPERVVATADLAAFLLLQLR
FT                   ELAALATELGHTDEARGWTRTAETIQTAMLDQLWSGERFLARGADSGDTWSSASLLDLM
FT                   PITLGEHLPENIAKTLATRIEAHLTPYGLATELPTSPHYRPDGYWRGPIWAPATVLIED
FT                   GLRRSGHQRLADEISARFRLLCETHGFAENFDALTGTGLRDRAYTWTAAAYLLLAEGHA
FT                   LRN"
     MTAARPGPAF SLHDIPFSAY GSWFGISPVL AEQTHAEDLH LVSHQNGMHA VLRLVPLDPT        60
     TGGRADTRVT ATPSLLSWRN DHGRIDLAYE SPDTVRLRGK GTALRVSAAA PTLTPFTGTY       120
     FFRDPAAGAY VFTSYETGRR YRLTVLSGAV RDASGGQALG SADRGLTITA DHGHGGTWEA       180
     AIEEFDSGRR PYSSARATFD EVVAAAERAF ADFADTVAPW RSSRTPAAEL AAYVLWSATV       240
     APAGLVTRPA VLMSKHWMDK VWSWDHCFNA LALAPGAPAL AWDQFSLPFD HQDESGALPD       300
     SVTHSEVLYN FVKPPIHGWT LAHLRRRLPE PLGHAELTAT YDRLRRWTDF WLTARRAPGA       360
     TLPHYQHGND SGWDNATTFD PERVVATADL AAFLLLQLRE LAALATELGH TDEARGWTRT       420
     AETIQTAMLD QLWSGERFLA RGADSGDTWS SASLLDLMPI TLGEHLPENI AKTLATRIEA       480
     HLTPYGLATE LPTSPHYRPD GYWRGPIWAP ATVLIEDGLR RSGHQRLADE ISARFRLLCE       540
     THGFAENFDA LTGTGLRDRA YTWTAAAYLL LAEGHALRN                              579
//

If you have problems or comments...

PBIL Back to PBIL home page