(data stored in ACNUC7421 zone)

EMBL: CP002047.PE415

CP002047.PE415       Location/Qualifiers
FT   CDS             complement(488979..489824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00415"
FT                   /product="putative integral membrane transport protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03536"
FT                   /db_xref="GOA:D7BYK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK8"
FT                   /protein_id="ADI03536.1"
FT                   /translation="MSTATTPRRHPGRTTWWKTATGLVLTGIMLFPVYWMLNASFTRDQ
FT                   DMRKSPPDLFPVHGTLEGYRAVLDQQLPYLGTSLVIGAGTVVLTVALAAPAGYALATLR
FT                   PRGGGLVSFLFLVAQMIPGIIMAMGFYAIYLSLGLLQSVPGLIVADSTLAVPFAVLIFT
FT                   AFMSGIPRELLQAAKTDGAGPFRTFWSIALPMSRNAVVTVSLFAFLWSWSDFVFAGTLV
FT                   NGGAHEPITLGIYHYIGNNNQEWNAIMATAVVASLPAAVILVLAQRYVAAGVAAGAVKD
FT                   "
     MSTATTPRRH PGRTTWWKTA TGLVLTGIML FPVYWMLNAS FTRDQDMRKS PPDLFPVHGT        60
     LEGYRAVLDQ QLPYLGTSLV IGAGTVVLTV ALAAPAGYAL ATLRPRGGGL VSFLFLVAQM       120
     IPGIIMAMGF YAIYLSLGLL QSVPGLIVAD STLAVPFAVL IFTAFMSGIP RELLQAAKTD       180
     GAGPFRTFWS IALPMSRNAV VTVSLFAFLW SWSDFVFAGT LVNGGAHEPI TLGIYHYIGN       240
     NNQEWNAIMA TAVVASLPAA VILVLAQRYV AAGVAAGAVK D                           281
//

If you have problems or comments...

PBIL Back to PBIL home page