(data stored in ACNUC7421 zone)

EMBL: CP002047.PE416

CP002047.PE416       Location/Qualifiers
FT   CDS             complement(489821..490801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00416"
FT                   /product="putative sugar transport integral membrane
FT                   protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03537"
FT                   /db_xref="GOA:D7BYK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYK9"
FT                   /protein_id="ADI03537.1"
FT                   /translation="MNRTAHLPDRPPALDRNGPATAKLPARTAPRRRPRSQQWAAWAFL
FT                   TPVTLYLVLFYAYPLYRNLDLSLRHYTVRSFVQGDAPFTGLANYRTVFDDPTFGPALIH
FT                   TVMFTAVCLFFQYAIGLALAVFFNQHFRLSVTLRALFLVPWLLPLIVSASTWSWMLNSD
FT                   SGVVNAALHIVGIGPVNWLTSPSWSLTSVIIANIWIGVPFNLVVLHSGLQSIPASLYEA
FT                   AALDGAGAWRRFWHITFPLLRPVSAITLLLGLVYTLKVFDIIWIMTKGGPADSSTTFAT
FT                   WSYQLGFGNLLPAFGPGAAVGNLLVLAALVFGLVYLRVQRKQYAS"
     MNRTAHLPDR PPALDRNGPA TAKLPARTAP RRRPRSQQWA AWAFLTPVTL YLVLFYAYPL        60
     YRNLDLSLRH YTVRSFVQGD APFTGLANYR TVFDDPTFGP ALIHTVMFTA VCLFFQYAIG       120
     LALAVFFNQH FRLSVTLRAL FLVPWLLPLI VSASTWSWML NSDSGVVNAA LHIVGIGPVN       180
     WLTSPSWSLT SVIIANIWIG VPFNLVVLHS GLQSIPASLY EAAALDGAGA WRRFWHITFP       240
     LLRPVSAITL LLGLVYTLKV FDIIWIMTKG GPADSSTTFA TWSYQLGFGN LLPAFGPGAA       300
     VGNLLVLAAL VFGLVYLRVQ RKQYAS                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page