(data stored in ACNUC7421 zone)

EMBL: CP002047.PE419

CP002047.PE419       Location/Qualifiers
FT   CDS             493576..496269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00419"
FT                   /product="hypothetical protein"
FT                   /note="COG3664 Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03540"
FT                   /db_xref="GOA:D7BYL2"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL2"
FT                   /protein_id="ADI03540.1"
FT                   /translation="MRPRRSPRTVSAGATAITALAALLALPGATGTARAAEPEQLTIDL
FT                   ATDTGAFHGGASGSLYGIYGDGVPSRNVLEGMHLRTVSTKAQDGPQHPGADALEVLPPF
FT                   VESGGKDVFIYMTDIYRGFPYQWPGADGPARLADFKEKIKKQVQQTLTMGDYKNHVVYV
FT                   PFNEPEGNMFGTGEWSYNKTSWLSDPQAYFEAWKEVYRLIKGLDPNARIAGPNTSVLYN
FT                   QVKDFLQYAKANDVVPDVMTWHELSSPAAVRTNVARYRQMEKEVGVGPLPINVNEYGHN
FT                   YHLSVPGQVMQWVSAIEESKIDADLAYWNIDGNLNDSAVEANKGNGQWWLFNAYGQMSG
FT                   HTVQVTAPHPNQQYTLQGVATLDEGKRQSRTLFGGKSGDADVVFKNIDPKLFGSTVHAT
FT                   VQEIPWTGQVGDSAQPLRLADRELAVGADGSVTLPMTGMNEMSAYQVVLSPGGNGGVPA
FT                   EPSVGWRKTYEAESAAYTGGGYSKNGPEGTPSNVGGFATSGAYNVGGLRTGSDGVLAFD
FT                   VEVPQDGTYDLSTFANSYNLYGRVKEQGPTNVFLRVDGKDPQELRLPLGYKWVVWGHTD
FT                   TTVKLTAGKHRITLAASDPDLGVTKGDAIIDKIDLSLRDARVTAPAIYEAEYATLSGAR
FT                   PGYTHPGVSGPGAVPLAKGASATFWVHSPTDGEATVLVDHLGGGRASLSLGGEKLDVSG
FT                   VGGGKKGTDNVRMFLSAGINKITVTGTSRELILDRLRVAPSSGTLVTKAYEAEGGAPTG
FT                   AAKVTDAYTFASGGKAVTGIGAGKANALTVDVVAERSGRHALTIRYSNAEQAPATHYNP
FT                   DPIARHADLSVGGGPARRILFPTTFHFNNFWDLTVPATLKKGTNRLTFTADELPDFNGD
FT                   TYNQYDQRSPYAPVIDQVAITPLVQD"
     MRPRRSPRTV SAGATAITAL AALLALPGAT GTARAAEPEQ LTIDLATDTG AFHGGASGSL        60
     YGIYGDGVPS RNVLEGMHLR TVSTKAQDGP QHPGADALEV LPPFVESGGK DVFIYMTDIY       120
     RGFPYQWPGA DGPARLADFK EKIKKQVQQT LTMGDYKNHV VYVPFNEPEG NMFGTGEWSY       180
     NKTSWLSDPQ AYFEAWKEVY RLIKGLDPNA RIAGPNTSVL YNQVKDFLQY AKANDVVPDV       240
     MTWHELSSPA AVRTNVARYR QMEKEVGVGP LPINVNEYGH NYHLSVPGQV MQWVSAIEES       300
     KIDADLAYWN IDGNLNDSAV EANKGNGQWW LFNAYGQMSG HTVQVTAPHP NQQYTLQGVA       360
     TLDEGKRQSR TLFGGKSGDA DVVFKNIDPK LFGSTVHATV QEIPWTGQVG DSAQPLRLAD       420
     RELAVGADGS VTLPMTGMNE MSAYQVVLSP GGNGGVPAEP SVGWRKTYEA ESAAYTGGGY       480
     SKNGPEGTPS NVGGFATSGA YNVGGLRTGS DGVLAFDVEV PQDGTYDLST FANSYNLYGR       540
     VKEQGPTNVF LRVDGKDPQE LRLPLGYKWV VWGHTDTTVK LTAGKHRITL AASDPDLGVT       600
     KGDAIIDKID LSLRDARVTA PAIYEAEYAT LSGARPGYTH PGVSGPGAVP LAKGASATFW       660
     VHSPTDGEAT VLVDHLGGGR ASLSLGGEKL DVSGVGGGKK GTDNVRMFLS AGINKITVTG       720
     TSRELILDRL RVAPSSGTLV TKAYEAEGGA PTGAAKVTDA YTFASGGKAV TGIGAGKANA       780
     LTVDVVAERS GRHALTIRYS NAEQAPATHY NPDPIARHAD LSVGGGPARR ILFPTTFHFN       840
     NFWDLTVPAT LKKGTNRLTF TADELPDFNG DTYNQYDQRS PYAPVIDQVA ITPLVQD          897
//

If you have problems or comments...

PBIL Back to PBIL home page