(data stored in ACNUC7421 zone)

EMBL: CP002047.PE423

CP002047.PE423       Location/Qualifiers
FT   CDS             complement(500463..501116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00423"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03544"
FT                   /db_xref="GOA:D7BYL6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL6"
FT                   /protein_id="ADI03544.1"
FT                   /translation="MADRARRGEQVSATRVALLDAAERLFAERGVHAVANRQISEAAGQ
FT                   GNNAAVSYHFGTKVDLVRAIARRHAERVEVGRVRMLDAIGESADLRDWVACAVRPVTEH
FT                   LEALGAPSWYARFIAQVSADPALRAVTVEEFAAGSPSMRRLQEGLEGCLPDLPAEVHAE
FT                   RAAMTRHLIAQMSAERERALADNAPTARASWQGTANGLIDAIVALWRAPFTREG"
     MADRARRGEQ VSATRVALLD AAERLFAERG VHAVANRQIS EAAGQGNNAA VSYHFGTKVD        60
     LVRAIARRHA ERVEVGRVRM LDAIGESADL RDWVACAVRP VTEHLEALGA PSWYARFIAQ       120
     VSADPALRAV TVEEFAAGSP SMRRLQEGLE GCLPDLPAEV HAERAAMTRH LIAQMSAERE       180
     RALADNAPTA RASWQGTANG LIDAIVALWR APFTREG                                217
//

If you have problems or comments...

PBIL Back to PBIL home page