(data stored in ACNUC7421 zone)

EMBL: CP002047.PE426

CP002047.PE426       Location/Qualifiers
FT   CDS             complement(503098..504111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00426"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /note="COG1995 Pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03547"
FT                   /db_xref="GOA:D7BYL9"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYL9"
FT                   /protein_id="ADI03547.1"
FT                   /translation="MPTPLPFIAVTMGDGAGIGPEVVVAALLDDAVLTRCRPVVIGDAQ
FT                   RLREAARILGLDCEIAAVDHPRDAEFTPGRVNVVDLGLLPADLPWGELSPVAGGAAYAY
FT                   IERAAALAVAGEVHAICTAPLNKEALHAAGHIYPGHTELLAHLTGTEEVSMMLSTEKVK
FT                   VIHVTTHIGLIDAVNRIEPGLVERTVRRGHQAMVRAGTPNPVIGVCGINPHAGENGLFG
FT                   YGEEEEKIVPALEVLRAEGVDARGPLPADTAFFLAGRGDYDLIVAMYHDQGHGPVKVLG
FT                   IEAGVNLTVGLPVIRTSVDHGTAFDIAGTGTAEAGSMVEALRQATEMATVPVTPAA"
     MPTPLPFIAV TMGDGAGIGP EVVVAALLDD AVLTRCRPVV IGDAQRLREA ARILGLDCEI        60
     AAVDHPRDAE FTPGRVNVVD LGLLPADLPW GELSPVAGGA AYAYIERAAA LAVAGEVHAI       120
     CTAPLNKEAL HAAGHIYPGH TELLAHLTGT EEVSMMLSTE KVKVIHVTTH IGLIDAVNRI       180
     EPGLVERTVR RGHQAMVRAG TPNPVIGVCG INPHAGENGL FGYGEEEEKI VPALEVLRAE       240
     GVDARGPLPA DTAFFLAGRG DYDLIVAMYH DQGHGPVKVL GIEAGVNLTV GLPVIRTSVD       300
     HGTAFDIAGT GTAEAGSMVE ALRQATEMAT VPVTPAA                                337
//

If you have problems or comments...

PBIL Back to PBIL home page