(data stored in ACNUC7421 zone)

EMBL: CP002047.PE439

CP002047.PE439       Location/Qualifiers
FT   CDS             517387..517761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03560"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN2"
FT                   /protein_id="ADI03560.1"
FT                   /translation="MPGMTDTEVILHDVLDRWKAGVDNHEPEQVASLFTEDAIFQGLRP
FT                   YSVGRRGVADYYASQPLGLSAAYRILESRRLAEDIALGYLTVDFSFTDRPTISINLLVL
FT                   LKRSEADWLISHYQVSSRLG"
     MPGMTDTEVI LHDVLDRWKA GVDNHEPEQV ASLFTEDAIF QGLRPYSVGR RGVADYYASQ        60
     PLGLSAAYRI LESRRLAEDI ALGYLTVDFS FTDRPTISIN LLVLLKRSEA DWLISHYQVS       120
     SRLG                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page