(data stored in ACNUC7421 zone)

EMBL: CP002047.PE441

CP002047.PE441       Location/Qualifiers
FT   CDS             518433..519449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00441"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="COG1063 Threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03562"
FT                   /db_xref="GOA:D7BYN4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN4"
FT                   /protein_id="ADI03562.1"
FT                   /translation="MRATMIYAPGDIRVENLPDPKIVNSTDAVIRTVAACVCGSDLWDY
FT                   RGINPVTEPHPIGHEYVGIVEEVGGDVSTVRPGQFVIGSFFASDNTCPICRAGYHTSCP
FT                   HREFVGGCQAEYVRIPLADGTLVATPERPAEDLIPSLLTLSDVMGTGWYAAKAAEVGPG
FT                   STAVVVGDGAVGLSGVIAAKELGAERIIAMSRHESRQKLALEFGATDIVTERGAEGIAR
FT                   VKELTGGIGADSVLECVGTPESMQQALLSTRPGGNVGFVGVPHGVAIDGEQLFFSHVGL
FT                   RGGPAPVRGYLPDLIQRVFDGRINPGKVFDLTLPLDEVAEGYKAMDERRAIKALLRP"
     MRATMIYAPG DIRVENLPDP KIVNSTDAVI RTVAACVCGS DLWDYRGINP VTEPHPIGHE        60
     YVGIVEEVGG DVSTVRPGQF VIGSFFASDN TCPICRAGYH TSCPHREFVG GCQAEYVRIP       120
     LADGTLVATP ERPAEDLIPS LLTLSDVMGT GWYAAKAAEV GPGSTAVVVG DGAVGLSGVI       180
     AAKELGAERI IAMSRHESRQ KLALEFGATD IVTERGAEGI ARVKELTGGI GADSVLECVG       240
     TPESMQQALL STRPGGNVGF VGVPHGVAID GEQLFFSHVG LRGGPAPVRG YLPDLIQRVF       300
     DGRINPGKVF DLTLPLDEVA EGYKAMDERR AIKALLRP                               338
//

If you have problems or comments...

PBIL Back to PBIL home page