(data stored in ACNUC7421 zone)

EMBL: CP002047.PE444

CP002047.PE444       Location/Qualifiers
FT   CDS             520454..521242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00444"
FT                   /product="hypothetical protein"
FT                   /note="COG3826 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03565"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN7"
FT                   /protein_id="ADI03565.1"
FT                   /translation="MHQLTPAADTLFSSAEADGAAPRILPTAGLAALSKLNWEELYAQL
FT                   NEEGVAVTPPLLSRAQCQEIIDTFDKPGLFRSTVVMQRYQFGRGTYKYYADPATTVPLI
FT                   QTLRELLYPPMAWMANRWAPQLNERTFPTALEELLAECADNGQHRSTPLLLRYGPGDYA
FT                   CLHQDIYGDIVFPLQIAIMLNQPGEDFTGGENVFVEQRPRFQSRAIVVKPRLGQGMIFP
FT                   VRHRPVRGKNGFRRHPMRHGTNAVETGHRNTLGIIFHNAR"
     MHQLTPAADT LFSSAEADGA APRILPTAGL AALSKLNWEE LYAQLNEEGV AVTPPLLSRA        60
     QCQEIIDTFD KPGLFRSTVV MQRYQFGRGT YKYYADPATT VPLIQTLREL LYPPMAWMAN       120
     RWAPQLNERT FPTALEELLA ECADNGQHRS TPLLLRYGPG DYACLHQDIY GDIVFPLQIA       180
     IMLNQPGEDF TGGENVFVEQ RPRFQSRAIV VKPRLGQGMI FPVRHRPVRG KNGFRRHPMR       240
     HGTNAVETGH RNTLGIIFHN AR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page