(data stored in ACNUC7421 zone)

EMBL: CP002047.PE445

CP002047.PE445       Location/Qualifiers
FT   CDS             521292..522023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00445"
FT                   /product="hypothetical protein"
FT                   /note="COG3826 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03566"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN8"
FT                   /protein_id="ADI03566.1"
FT                   /translation="MSQTPHPAGPVVDSIAQCDWAALTDELGEYGSALTGRLLTAAECR
FT                   EIAALYHEPGHFRTTVDMARHRFGSGQYRYFTHDLPKVVRELREAFYPRLLPIARDWAA
FT                   KLGRPAPWPDTLQEWIAMCHEAGQSKSAQILLRYGPGDWNALHRDVFGEMVFPLQVVIG
FT                   LDAPGSDFTGGEFLMTEQRPRAQSRGSSTTLFQGHGLVFTTRDRPVATKRGWANGPMRH
FT                   GVSTVRSGRRHTLGLVFHDAA"
     MSQTPHPAGP VVDSIAQCDW AALTDELGEY GSALTGRLLT AAECREIAAL YHEPGHFRTT        60
     VDMARHRFGS GQYRYFTHDL PKVVRELREA FYPRLLPIAR DWAAKLGRPA PWPDTLQEWI       120
     AMCHEAGQSK SAQILLRYGP GDWNALHRDV FGEMVFPLQV VIGLDAPGSD FTGGEFLMTE       180
     QRPRAQSRGS STTLFQGHGL VFTTRDRPVA TKRGWANGPM RHGVSTVRSG RRHTLGLVFH       240
     DAA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page