(data stored in ACNUC7421 zone)

EMBL: CP002047.PE446

CP002047.PE446       Location/Qualifiers
FT   CDS             522400..523440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00446"
FT                   /product="aminotransferase"
FT                   /note="COG1168 Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03567"
FT                   /db_xref="GOA:D7BYN9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYN9"
FT                   /protein_id="ADI03567.1"
FT                   /translation="MDVPLAEPVAQAILDTVALGDTGYPTGRGYAEALAKFASERWDWD
FT                   GLTLERTAIVPDVMLGIVEMLKLVSGPGDPVIVNSPVYPPFYQLLENLGRPIIEAPLGA
FT                   DDRLDPAVLQGAFEHAREDGGRPVYLLCSPHNPTGTVHTADELADVAALARTGGVRVVV
FT                   DEIHAPIVAAGAIFVPYLSVPGSESGLSLMSASKAWNLAGLKAALAIAGPDAADDLDRL
FT                   PEAIGHPSHVGIIAHTAALRDGGDWLDSLLAGVDDNRRLLAHLLAEHLPAVRYAPGQAT
FT                   YLAWLDCRGLGLDDDPAAVFLERGRVALSSGIPFGTGGAGFVRLNLATSPTLLTEAVRR
FT                   MAAALD"
     MDVPLAEPVA QAILDTVALG DTGYPTGRGY AEALAKFASE RWDWDGLTLE RTAIVPDVML        60
     GIVEMLKLVS GPGDPVIVNS PVYPPFYQLL ENLGRPIIEA PLGADDRLDP AVLQGAFEHA       120
     REDGGRPVYL LCSPHNPTGT VHTADELADV AALARTGGVR VVVDEIHAPI VAAGAIFVPY       180
     LSVPGSESGL SLMSASKAWN LAGLKAALAI AGPDAADDLD RLPEAIGHPS HVGIIAHTAA       240
     LRDGGDWLDS LLAGVDDNRR LLAHLLAEHL PAVRYAPGQA TYLAWLDCRG LGLDDDPAAV       300
     FLERGRVALS SGIPFGTGGA GFVRLNLATS PTLLTEAVRR MAAALD                      346
//

If you have problems or comments...

PBIL Back to PBIL home page