(data stored in ACNUC7421 zone)

EMBL: CP002047.PE447

CP002047.PE447       Location/Qualifiers
FT   CDS             complement(523499..524101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00447"
FT                   /product="hypothetical protein"
FT                   /note="COG2176 DNA polymerase III, alpha subunit
FT                   (gram-positive type)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03568"
FT                   /db_xref="GOA:D7BYP0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP0"
FT                   /protein_id="ADI03568.1"
FT                   /translation="MSTFVVFDLEFTTWQGALEQDWGAPGQLREIVQIGALRLREDFSV
FT                   VEEYEALVRPVVNPQLSSYFAELTGIDQETVDREGASAAEALGDFLGFCQGQSVLSYGN
FT                   DMVVLGENVGWARARGENVKNGFLGAYFLNIRSWLNTVAPETENVNVGRLWQVLDLPKP
FT                   AEGKEHSALFDCYSFAAAIKHLCGTGAALPEGCMRCP"
     MSTFVVFDLE FTTWQGALEQ DWGAPGQLRE IVQIGALRLR EDFSVVEEYE ALVRPVVNPQ        60
     LSSYFAELTG IDQETVDREG ASAAEALGDF LGFCQGQSVL SYGNDMVVLG ENVGWARARG       120
     ENVKNGFLGA YFLNIRSWLN TVAPETENVN VGRLWQVLDL PKPAEGKEHS ALFDCYSFAA       180
     AIKHLCGTGA ALPEGCMRCP                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page