(data stored in ACNUC7421 zone)

EMBL: CP002047.PE448

CP002047.PE448       Location/Qualifiers
FT   CDS             complement(524300..524893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03569"
FT                   /db_xref="GOA:D7BYP1"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP1"
FT                   /protein_id="ADI03569.1"
FT                   /translation="MPMNTQPLGPGSVVSPRVLASVSGPSVAVPAPDRLVHLQFRRFAG
FT                   CPVCNLHLRSVVRRHGEIEAAGVREVVVFHSPAEELLEHTADLPFAVIADPDKRLYAEF
FT                   GVESAPRSLLSPRAWGPILRAILRSTWAILRRRERGPAGRPHGGRLGLPADFLIATDGR
FT                   VVAAKYGEHVYDQWSVDELLELSGRAPRPNLTTR"
     MPMNTQPLGP GSVVSPRVLA SVSGPSVAVP APDRLVHLQF RRFAGCPVCN LHLRSVVRRH        60
     GEIEAAGVRE VVVFHSPAEE LLEHTADLPF AVIADPDKRL YAEFGVESAP RSLLSPRAWG       120
     PILRAILRST WAILRRRERG PAGRPHGGRL GLPADFLIAT DGRVVAAKYG EHVYDQWSVD       180
     ELLELSGRAP RPNLTTR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page