(data stored in ACNUC7421 zone)

EMBL: CP002047.PE45

CP002047.PE45        Location/Qualifiers
FT   CDS             complement(42319..42618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00045"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="COG1062 Zn-dependent alcohol dehydrogenases, class
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03166"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSY9"
FT                   /protein_id="ADI03166.1"
FT                   /translation="MGDAVPCRDIPRFLDLWRAGQMPVERMHTGILPLTGISTAMEELA
FT                   SGRAIRQVIDTSGMLDVRPVDRGSGCARWPKGACRRHVATTKTLSCVVRRTRRL"
     MGDAVPCRDI PRFLDLWRAG QMPVERMHTG ILPLTGISTA MEELASGRAI RQVIDTSGML        60
     DVRPVDRGSG CARWPKGACR RHVATTKTLS CVVRRTRRL                               99
//

If you have problems or comments...

PBIL Back to PBIL home page