(data stored in ACNUC7421 zone)

EMBL: CP002047.PE452

CP002047.PE452       Location/Qualifiers
FT   CDS             complement(527054..528028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00452"
FT                   /product="2-keto-3-deoxy-gluconate kinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03573"
FT                   /db_xref="GOA:D7BYP5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYP5"
FT                   /protein_id="ADI03573.1"
FT                   /translation="MSYEEQPRGRPVPEVVTCGEAMLLMVAEPGVPLERATVFRRSVAG
FT                   AESNVATGLARLGHHTRWLGRVGDDPSGRSVLAQLRADAIDTSYAVVDPSAPTGLLLRD
FT                   SHPARAIDVQYHRAGSAASRLTADELTAEMVEGARLVHITGITPMLSDSAHTATLRLLE
FT                   LARAAGAMVSFDPNVRLKLGTPERWRSVVGPLLGQADITLAGEDELELLGATAPGLLAA
FT                   GVTTAVVKHRDKSATCSTADGTWRQDAFRVPAADPVGAGDAFAAGFLSGVLSGAPYDRC
FT                   LAAGAAVAALVVQCTTDTDGLPDRQGLVRALSSFMGAAETVHR"
     MSYEEQPRGR PVPEVVTCGE AMLLMVAEPG VPLERATVFR RSVAGAESNV ATGLARLGHH        60
     TRWLGRVGDD PSGRSVLAQL RADAIDTSYA VVDPSAPTGL LLRDSHPARA IDVQYHRAGS       120
     AASRLTADEL TAEMVEGARL VHITGITPML SDSAHTATLR LLELARAAGA MVSFDPNVRL       180
     KLGTPERWRS VVGPLLGQAD ITLAGEDELE LLGATAPGLL AAGVTTAVVK HRDKSATCST       240
     ADGTWRQDAF RVPAADPVGA GDAFAAGFLS GVLSGAPYDR CLAAGAAVAA LVVQCTTDTD       300
     GLPDRQGLVR ALSSFMGAAE TVHR                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page