(data stored in ACNUC7421 zone)

EMBL: CP002047.PE457

CP002047.PE457       Location/Qualifiers
FT   CDS             complement(532901..533365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03578"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D7C087"
FT                   /protein_id="ADI03578.1"
FT                   /translation="MIPVTVSIDVPQTPEQVYDFLDVMAHHERFTNHYLTDYRYSGPDR
FT                   GIGSCATVTVTLGGTKTDVAIEVVEAEAPRRIVERNVSAAGRRVAHGTYTIEPLPTGGS
FT                   HISFTYAWERAPLADRLLSPVVRPTMRRANRTVMQRLADELARHVSTADS"
     MIPVTVSIDV PQTPEQVYDF LDVMAHHERF TNHYLTDYRY SGPDRGIGSC ATVTVTLGGT        60
     KTDVAIEVVE AEAPRRIVER NVSAAGRRVA HGTYTIEPLP TGGSHISFTY AWERAPLADR       120
     LLSPVVRPTM RRANRTVMQR LADELARHVS TADS                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page