(data stored in ACNUC7421 zone)

EMBL: CP002047.PE460

CP002047.PE460       Location/Qualifiers
FT   CDS             complement(536035..536214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03581"
FT                   /db_xref="UniProtKB/TrEMBL:D7C090"
FT                   /protein_id="ADI03581.1"
FT                   /translation="MSTMAFTKIRMATWPTSRLFQLVCCSLPGTPVLVPTLPTLLSCMK
FT                   RSAFSLDPYAVEIA"
     MSTMAFTKIR MATWPTSRLF QLVCCSLPGT PVLVPTLPTL LSCMKRSAFS LDPYAVEIA         59
//

If you have problems or comments...

PBIL Back to PBIL home page