(data stored in ACNUC7421 zone)

EMBL: CP002047.PE462

CP002047.PE462       Location/Qualifiers
FT   CDS             537570..538280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03583"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7C092"
FT                   /protein_id="ADI03583.1"
FT                   /translation="MTSMDDILREIADLREVMTNRFRQVEALTNLYAIIPVKHAMPQPT
FT                   KWTASPDLLLFLISHIQERRPVSILDIGSGATTVWMANALRHFEIPGKIISIDHDKSFG
FT                   AVTAATLTQQGLDTYADVRIAPLVEVDIKGERRHWYDPTQLEDVENCDMAVIDGPPGFT
FT                   HPLSRYPALPMLESKLSSDARIFLDDASRPDEREIVERWCREYPDWSSDFIDHEKGTAV
FT                   LARRTVIADEYPAE"
     MTSMDDILRE IADLREVMTN RFRQVEALTN LYAIIPVKHA MPQPTKWTAS PDLLLFLISH        60
     IQERRPVSIL DIGSGATTVW MANALRHFEI PGKIISIDHD KSFGAVTAAT LTQQGLDTYA       120
     DVRIAPLVEV DIKGERRHWY DPTQLEDVEN CDMAVIDGPP GFTHPLSRYP ALPMLESKLS       180
     SDARIFLDDA SRPDEREIVE RWCREYPDWS SDFIDHEKGT AVLARRTVIA DEYPAE           236
//

If you have problems or comments...

PBIL Back to PBIL home page